Products

View as table Download

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)

Goat Polyclonal Antibody against GPX7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2.

Rabbit Polyclonal Anti-Gpx7 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Gpx7 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Gpx7. Synthetic peptide located within the following region: RTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKV

GPX7 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-187 of human GPX7 (NP_056511.2).
Modifications Unmodified