Products

View as table Download

Rabbit Polyclonal Anti-TF2H2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2

GTF2H2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-TF2H2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2.

Rabbit Polyclonal Anti-GTF2H2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the C terminal of human GTF2H2. Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC

Rabbit Polyclonal Anti-GTF2H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the N terminal of human GTF2H2. Synthetic peptide located within the following region: DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTL

Rabbit Polyclonal Anti-GTF2H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD

Rabbit Polyclonal Anti-Gtf2h2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gtf2h2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Gtf2h2. Synthetic peptide located within the following region: SLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKP

GTF2H2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GTF2H2

GTF2H2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF2H2 (NP_001506.1).
Modifications Unmodified