Products

View as table Download

GTSE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GTSE1

Rabbit Polyclonal Anti-GTSE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTSE1 antibody: synthetic peptide directed towards the N terminal of human GTSE1. Synthetic peptide located within the following region: NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA

Rabbit Polyclonal Anti-GTSE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTSE1 antibody: synthetic peptide directed towards the middle region of human GTSE1. Synthetic peptide located within the following region: IDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF

GTSE1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 691~720 amino acids from the C-terminal region of human GTSE1

GTSE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GTSE1

GTSE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human GTSE1 (NP_057510.4).
Modifications Unmodified

GTSE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human GTSE1 (NP_057510.4).
Modifications Unmodified