Germany
Japan
United Kingdom
China
Products
Rabbit polyclonal anti-IL11RA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL11RA. |
Rabbit Polyclonal Anti-IL11RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL11RA antibody: synthetic peptide directed towards the middle region of human IL11RA. Synthetic peptide located within the following region: FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA |
Rabbit Polyclonal Anti-IL11RA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL11RA antibody: synthetic peptide directed towards the N terminal of human IL11RA. Synthetic peptide located within the following region: QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD |
Anti-IL11RA Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 185-371 amino acids of Human Interleukin-11 receptor subunit alpha |
Anti-IL11RA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 185-371 amino acids of Human Interleukin-11 receptor subunit alpha |
IL11RA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-290 of human IL11RA (NP_001136256.1). |
| Modifications | Unmodified |
Active filters
Category
-
- Antibodies
-
-
-
Target Symbol
- IL11RA