Products

View as table Download

Rabbit Polyclonal Anti-INMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT. Synthetic peptide located within the following region: KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP

INMT Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human INMT (NP_006765.4).
Modifications Unmodified