Germany
Japan
United Kingdom
China
Products
Rabbit polyclonal Kv2.1 (Ser805) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv2.1 around the phosphorylation site of serine 805 (P-T-SP-P-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Kv2.1 (Ser805) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Kv2.1 around the phosphorylation site of Serine 805 |
| Modifications | Phospho-specific |
Mouse Monoclonal Anti-Kv2.1 Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-Kv2.1 (Extracellular) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1. Synthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT |
Rabbit Polyclonal Anti-KCNB1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNB1 |
KCNB1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNB1 |
Active filters
Category
-
- Antibodies
-
-
-
Target Symbol
- KCNB1