Products

View as table Download

Rabbit polyclonal anti-LAMC3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMC3.

Rabbit Polyclonal Anti-LAMC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT