Products

cDNA Clones (21)
Proteins (12)
RNAi (12)
Antibodies (6)
Gene Expression (6)
Assay Kits (1)
Jump to Filters
View as table Download
Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
TA347963

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-LEG7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LEG7 Antibody: A synthesized peptide derived from human LEG7
Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
TA313110

USD 345.00

In Stock

Rabbit polyclonal anti-LEG7 (Galectin-7) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LEG7.
Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
TA319111

USD 355.00

3 Weeks

Rabbit polyclonal anti-Galectin-7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human Galectin-7
Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
TA350678

USD 345.00

In Stock

Rabbit Polyclonal Anti-LGALS7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LGALS7
Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
TA358635

USD 360.00

5 Days

LGALS7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
TA358636

USD 360.00

5 Days

LGALS7 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP