Products

cDNA Clones (43)
Proteins (17)
RNAi (12)
Gene Expression (8)
Antibodies (5)
Jump to Filters
View as table Download
MAZ Rabbit Polyclonal Antibody
TA314180

USD 345.00

In Stock

Rabbit polyclonal anti-MAZ antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAZ.
MAZ Rabbit Polyclonal Antibody
TA335836

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAZ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAZ Antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
MAZ Rabbit Polyclonal Antibody
TA334772

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAZ antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: QGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPPPTPQAPAAEPLQVD
MAZ Rabbit Polyclonal Antibody
TA334773

USD 375.00

5 Days

Rabbit Polyclonal Anti-MAZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAZ antibody: synthetic peptide directed towards the middle region of human MAZ. Synthetic peptide located within the following region: ALEKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMP
MAZ Rabbit Polyclonal Antibody
TA378366

USD 220.00

3 Weeks

MAZ Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-420 of human MAZ (NP_001036004.1).
Modifications Unmodified