Rabbit Polyclonal Anti-NDUFB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFB4 Antibody is: synthetic peptide directed towards the C-terminal region of Human NDUFB4. Synthetic peptide located within the following region: ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK |
NDUFB4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFB4 |
NDUFB4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China