Products

cDNA Clones (59)
Proteins (14)
RNAi (12)
Gene Expression (8)
Antibodies (6)
Jump to Filters
View as table Download
RPL28 Rabbit Polyclonal Antibody
TA314466

USD 345.00

In Stock

Rabbit polyclonal anti-RPL28 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL28.
RPL28 Rabbit Polyclonal Antibody
TA338304

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPL28. Synthetic peptide located within the following region: LIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSS
RPL28 Rabbit Polyclonal Antibody
TA338305

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPL28. Synthetic peptide located within the following region: SSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV
RPL28 Rabbit Polyclonal Antibody
TA365940

USD 380.00

4 Weeks

RPL28 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPL28
RPL28 Rabbit Polyclonal Antibody
TA370287

USD 380.00

4 Weeks

RPL28 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPL28
RPL28 Rabbit Polyclonal Antibody
TA381052

USD 220.00

3 Weeks

RPL28 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL28 (NP_000982.2).
Modifications Unmodified