SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-SOS1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sos1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sos1. Synthetic peptide located within the following region: YFELLKQLEEKSEDQEDKECMKQAITALLNVQSGMEKICSKSLAKRRLSE |
SOS1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human SOS1 |
SOS1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1034-1333 of human SOS1 (NP_005624.2). |
Modifications | Unmodified |