Products

View as table Download

Rabbit Polyclonal Anti-SRGAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRGAP3 antibody is: synthetic peptide directed towards the N-terminal region of Human SRGAP3. Synthetic peptide located within the following region: SSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV

Rabbit Polyclonal Anti-SRGAP3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SRGAP3

SRGAP3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SRGAP3

SRGAP3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SRGAP3