Products

View as table Download

TAF2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1159~1188 amino acids from the C-terminal region of human TAF2

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH

Carrier-free (BSA/glycerol-free) TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human TAF2.

TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated