Rabbit Polyclonal TTYH1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TTYH1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TTYH1. |
Rabbit Polyclonal TTYH1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TTYH1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TTYH1. |
Rabbit Polyclonal Anti-TTYH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TTYH1 Antibody: synthetic peptide directed towards the N terminal of human TTYH1. Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA |