Products

View as table Download

Rabbit Polyclonal Anti-PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A.

TXNIP rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TXNIP

Rabbit Polyclonal TXNIP Antibody

Applications WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-150 of human TxNIP was used as the immunogen.

Rabbit Polyclonal Anti-TXNIP Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TXNIP antibody: synthetic peptide directed towards the C terminal of human TXNIP. Synthetic peptide located within the following region: DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP

Rabbit Polyclonal Anti-TXNIP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TXNIP

TXNIP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXNIP

TXNIP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TXNIP

TXNIP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human TXNIP (NP_006463.3).
Modifications Unmodified