Products

cDNA Clones (43)
Proteins (21)
RNAi (13)
Gene Expression (7)
Antibodies (5)
Jump to Filters
View as table Download
USP8 Rabbit Polyclonal Antibody
TA383176

USD 275.00

3 Weeks

USP8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human USP8 (NP_005145.3).
Modifications Unmodified
USP8 Rabbit Polyclonal Antibody
TA383176S

USD 85.00

3 Weeks

USP8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human USP8 (NP_005145.3).
Modifications Unmodified
USP8 Rabbit Polyclonal Antibody
TA342558

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA
USP8 Rabbit Polyclonal Antibody
TA342559

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI
USP8 Rabbit Polyclonal Antibody
TA361967

USD 360.00

5 Days

USP8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human USP8