ZNF117 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human ZNF117 |
ZNF117 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human ZNF117 |
Rabbit Polyclonal Anti-ZNF117 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-ZNF117 antibody: synthetic peptide directed towards the middle region of human ZNF117. Synthetic peptide located within the following region: EIPYKCEKCVRAFNQASKLTEHKLIHTGEKRYECEECGKAFNRSSKLTEH |
Rabbit Polyclonal Anti-ZNF117 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-ZNF117 antibody: synthetic peptide directed towards the N terminal of human ZNF117. Synthetic peptide located within the following region: QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM |