Products

cDNA Clones (9)
RNAi (7)
Gene Expression (4)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
ZNF117 (N-term) Rabbit Polyclonal Antibody
AP54668PU-N

USD 450.00

2 Weeks

ZNF117 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human ZNF117
ZNF117 Rabbit Polyclonal Antibody
TA342454

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF117 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-ZNF117 antibody: synthetic peptide directed towards the middle region of human ZNF117. Synthetic peptide located within the following region: EIPYKCEKCVRAFNQASKLTEHKLIHTGEKRYECEECGKAFNRSSKLTEH
ZNF117 Rabbit Polyclonal Antibody
TA342455

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF117 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-ZNF117 antibody: synthetic peptide directed towards the N terminal of human ZNF117. Synthetic peptide located within the following region: QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM