Products

Antibodies (1)
cDNA Clones (1)
Jump to Filters
View as table Download
EDEM1 (NM_014674) Human Tagged ORF Clone
RC205655

USD 480.00

In Stock

EDEM1 (Myc-DDK-tagged)-Human ER degradation enhancer, mannosidase alpha-like 1 (EDEM1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EDEM1 Rabbit Polyclonal Antibody
TA341949

USD 375.00

5 Days

Rabbit Polyclonal Anti-EDEM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDEM1 antibody: synthetic peptide directed towards the N terminal of human EDEM1. Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI