Products

Antibodies (1)
cDNA Clones (1)
Jump to Filters
View as table Download
CBS (NM_000071) Human Tagged ORF Clone
RC201755

USD 420.00

In Stock

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CBS Rabbit Polyclonal Antibody
TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE