Products

View as table Download

Rabbit polyclonal anti-GPR173 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR173.

Rabbit polyclonal anti-GPR173 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR173.

Rabbit Polyclonal Anti-GPR173 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR173 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR173. Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV

Rabbit Polyclonal Anti-GPR173 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Rabbit (100%); Mouse, Rat, Hamster, Bovine (95%).

Rabbit Polyclonal Anti-GPR173 Antibody (Transmembrane Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from 5th transmembrane domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Rabbit (100%); Opossum (95%).

Rabbit Polyclonal Anti-GPR173 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen GPR173 / SREB3 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Rabbit (100%); Panda (95%); Hamster, Elephant (90%).