Products

View as table Download

Rabbit polyclonal anti-GluR2/3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR2/3.

Rabbit anti-GRM3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM3

Rabbit Polyclonal Anti-GluR2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GluR2/3 Antibody: A synthesized peptide derived from human GluR2/3

Rabbit Polyclonal Anti-GRM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM3 antibody is: synthetic peptide directed towards the N-terminal region of Human GRM3. Synthetic peptide located within the following region: NHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVV

Rabbit Polyclonal Anti-GRM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM3 antibody is: synthetic peptide directed towards the C-terminal region of HUMAN GRM3. Synthetic peptide located within the following region: RDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMA

Anti-GRM3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-276 amino acids of human glutamate receptor, metabotropic 3

Anti-GRM3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-276 amino acids of human glutamate receptor, metabotropic 3

Anti-GRM3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 366-380 amino acids of Human glutamate receptor, metabotropic 3

Anti-GRM3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 366-380 amino acids of Human glutamate receptor, metabotropic 3