Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SUCNR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUCNR1. |
Products
View as table Download
GPR91 (SUCNR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 102-154 of Human GPR91. |
Rabbit Polyclonal Anti-SUCNR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1 |
Rabbit Polyclonal Anti-SUCNR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUCNR1 antibody is: synthetic peptide directed towards the middle region of Human SUCNR1. Synthetic peptide located within the following region: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI |
Rabbit Polyclonal Anti-SUCNR1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SUCNR1 / GPR91 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR91. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Dog, Bovine, Panda, Horse (88%). |
Rabbit Polyclonal Anti-SUCNR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SUCNR1 / GPR91 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR91. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gorilla, Gibbon, Marmoset (94%). |
Active filters
Target Symbol
- SUCNR1
Clonalities
- Polyclonal
Families
- GPCR