Products

View as table Download

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the N terminal of human GFPT2. Synthetic peptide located within the following region: DLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQ

Rabbit Polyclonal Anti-GFPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH

GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2

Rabbit Polyclonal Anti-GFPT1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen GFPT1 / GFAT antibody was raised against synthetic 12 amino acid peptide from N-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken (100%); Turkey, Platypus (92%).

Rabbit Polyclonal Anti-GFPT1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen GFPT1 / GFAT antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Bovine, Horse, Pig, Opossum, Guinea pig (100%); Dog, Bat (93%); Turkey, Zebra finch, Chicken (86%).

Rabbit Polyclonal Anti-PPAT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPAT