KCNH7 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 58~87 amino acids from the N-terminal region of human KCNH7 |
KCNH7 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 58~87 amino acids from the N-terminal region of human KCNH7 |
Rabbit Polyclonal Anti-KCNH7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the middle region of human KCNH7. Synthetic peptide located within the following region: LEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYVH |
Rabbit Polyclonal Anti-KCNH7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV |