Rabbit Polyclonal Anti-BHLHB3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3 |
Rabbit Polyclonal Anti-BHLHB3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3 |
Rabbit Polyclonal Anti-BHLHB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI |
BHLHE41 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BHLHE41 (NP_110389.1). |
Modifications | Unmodified |