Products

View as table Download

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D

CSNK1D rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D

CSNK1D Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK1D (NP_620693.1).
Modifications Unmodified