Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS |
Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL |
GM2A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GM2A |
GM2A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-193 of human GM2A (NP_000396.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
