Products

Jump to Filters
View as table Download
Gpihbp1 Rabbit Polyclonal Antibody
RA25016-100

USD 385.00

2 Weeks

Gpihbp1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
GPIHBP1 Rabbit Polyclonal Antibody
TA337743

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPIHBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPIHBP1 antibody is: synthetic peptide directed towards the C-terminal region of Human GPIHBP1. Synthetic peptide located within the following region: QVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLA
GPIHBP1 Rabbit Polyclonal Antibody
TA376711

USD 220.00

3 Weeks

GPIHBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human GPIHBP1 (NP_835466.2).
Modifications Unmodified