Products

View as table Download

Rabbit Polyclonal Anti-Abca7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL

Rabbit Polyclonal ABCA7 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7.