Products

View as table Download

Goat Anti-NLGN4X (aa51-65) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NYGKIRGLRTPLPNE, from the internal region (near N Terminus) of the protein sequence according to NP_065793.1.

Rabbit Polyclonal Anti-NLGN4X Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the N terminal of human NLGN4X. Synthetic peptide located within the following region: SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN

Rabbit Polyclonal Anti-NLGN4X Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the middle region of human NLGN4X. Synthetic peptide located within the following region: ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE