Products

View as table Download

E2F5 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-E2F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN

Rabbit anti E2F-5 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated