Products

View as table Download

Rabbit Polyclonal Anti-ABP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801)

ABP1 (AOC1) rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant Human Diamine Oxidase (DAO).

ABP1 (AOC1) rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant Human Diamine Oxidase (DAO).

ABP1 (AOC1) goat polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant Human Diamine Oxidase (DAO).

ABP1 (AOC1) goat polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant Human Diamine Oxidase (DAO).