Products

View as table Download

Rabbit Polyclonal Anti-HNRPM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPM antibody: synthetic peptide directed towards the N terminal of human HNRPM. Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE

Rabbit Polyclonal Anti-hnRNP M Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M

Rabbit Polyclonal Anti-hnRNP M Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRNP M Antibody: A synthesized peptide derived from human hnRNP M

Rabbit Polyclonal Anti-HNRNPM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPM