Rabbit polyclonal Anti-RPL5 Antibody
| Applications | WB |
| Reactivities | Arabidopsis thaliana, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL5 antibody: synthetic peptide directed towards the N terminal of human RPL5. Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP |
Rabbit Polyclonal Anti-RPS3A Antibody
| Applications | WB |
| Reactivities | Arabidopsis thaliana, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF |
Anti-S6 Kinase 1 (Thr449) Antibody
| Applications | WB |
| Reactivities | Arabidopsis |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr449 of Arabidopsis S6K1, conjugated to keyhole limpet hemocyanin (KLH). |
Germany
Japan
United Kingdom
China
