Rabbit Polyclonal Somatostatin Receptor 2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Somatostatin Receptor 2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Somatostatin Receptor 2 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
Somatostatin Receptor 2 (SSTR2) rabbit polyclonal antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Somatostatin Receptor 2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the c-terminus of rat SSR2. |
Rabbit polyclonal Anti-Somatostatin Receptor Type 2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)ERSDSKQDKSRLNETTETQRT corresponding to residues 339-359 of rat Somatostatin Receptor Type 2? . Intracellular, C-terminus. |
Rabbit Polyclonal Anti-SSTR2 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SSTR2 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human SSTR2. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Chicken (100%); Platypus, Lizard, Xenopus, Stickleback, Pufferfish (94%); Zebrafish (83%). |
Rabbit Polyclonal Anti-SSTR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SSTR2 antibody is: synthetic peptide directed towards the C-terminal region of Human SSTR2. Synthetic peptide located within the following region: KKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
Rabbit Polyclonal Anti-SSTR2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SSTR2 antibody: synthetic peptide directed towards the middle region of human SSTR2. Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL |
Anti-SSTR2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
Anti-SSTR2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
SSTR2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SSTR2 (NP_001041.1). |
Modifications | Unmodified |
SSTR2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SSTR2 (NP_001041.1). |
Modifications | Unmodified |