Products

Jump to Filters
View as table Download
ABCA7 Rabbit Polyclonal Antibody
TA331841

USD 375.00

In Stock

Rabbit Polyclonal Anti-Abca7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
ABCA7 Rabbit Polyclonal Antibody
TA373122

USD 275.00

3 Weeks

ABCA7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCA7.