Products

View as table Download

Rabbit polyclonal ASPA Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-110 amino acids from the N-terminal region of human ASPA.

Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381)

Goat Anti-Aspa (mouse) Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLSAKSIRSTLH, from the C Terminus of the protein sequence according to NP_075602.2.

Rabbit polyclonal Anti-ASPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPA antibody: synthetic peptide directed towards the N terminal of human ASPA. Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Rabbit polyclonal Anti-ASPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPA antibody: synthetic peptide directed towards the middle region of human ASPA. Synthetic peptide located within the following region: IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL

Rabbit Polyclonal Anti-ASPA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASPA

ASPA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASPA

ASPA Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human ASPA (NP_001121557.1).
Modifications Unmodified