Products

View as table Download

Rabbit polyclonal anti-CCR2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding to amino acid 353 of rat CCR2

Rabbit Polyclonal CCR2 Antibody

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the human CCR2 protein (within residues 20-100). [Swiss-Prot# P00338]

Rabbit Polyclonal Anti-CCR2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Rabbit Polyclonal Anti-CCR2 Antibody (N-Terminus)

Applications IHC
Reactivities Tested: Human
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%).

Rabbit Polyclonal CCR2 Antibody

Applications ELISA, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal CCR2 Antibody

Applications FC
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of the mouse CCR2 protein (within residues 20-100). [Swiss-Prot# P51683]

Rabbit Polyclonal Anti-CCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCR2 antibody is: synthetic peptide directed towards the N-terminal region of Human CCR2. Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF

Rabbit Polyclonal Anti-CCR2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Tested: Human; Predicted: Monkey
Immunogen CCR2 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%); Monkey (90%).

Rabbit Polyclonal Anti-CCR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR2

CCR2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

CCR2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CCR2.
Modifications Unmodified

CCR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 315-374 of human CCR2 (NP_001116513.2).
Modifications Unmodified