Products

View as table Download

Rabbit anti-CLDN11 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CLDN11

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Rabbit Polyclonal Anti-Claudin 11 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11

Rabbit Polyclonal Anti-Claudin 11 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11

Rabbit polyclonal Claudin 11 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 11.

Oligodendrocyte Specific Protein (CLDN11) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide from C-terminal of human claudin 11 protein

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11

CLDN11 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CLDN11

CLDN11 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11

CLDN11 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN11 (NP_005593.2).
Modifications Unmodified