Products

Jump to Filters
View as table Download
Cytochrome P450 2C9 (CYP2C9) Rabbit Polyclonal Antibody
TA346225

USD 475.00

5 Days

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV
Cytochrome P450 2C9 (CYP2C9) Rabbit Polyclonal Antibody
TA349844

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9
CYP2C9 Rabbit Polyclonal Antibody
TA364739

USD 380.00

4 Weeks

CYP2C9 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9
Cytochrome P450 2C9 (CYP2C9) Rabbit Polyclonal Antibody
TA375285

USD 220.00

3 Weeks

CYP2C9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-490 of human CYP2C9 (NP_000762.2).
Modifications Unmodified