GPR78 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | GPR78 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GPR78. Percent identity with other species by BLAST analysis: Human, Gorilla (100%). |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR78 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR78. Synthetic peptide located within the following region: MVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDS |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR78 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR78. Synthetic peptide located within the following region: ILSKCLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSS |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR78 |
GPR78 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR78 |
GPR78 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 294-363 of human GPR78 (NP_543009.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
