Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-JMJD1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD1B antibody: synthetic peptide directed towards the C terminal of human JMJD1B. Synthetic peptide located within the following region: VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII |
Rabbit Polyclonal Anti-KDM3B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KDM3B |
KDM3B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KDM3B |
KDM3B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KDM3B |
KDM3B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KDM3B |
KDM3B Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1059-1283 of human KDM3B (NP_057688.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KDM3B
Clonalities
- Polyclonal