Products

View as table Download

Rabbit Polyclonal Anti-MRLC2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MRLC2 Antibody: A synthesized peptide derived from human MRLC2

Rabbit Polyclonal Anti-Myosin regulatory light chain 2 (Phospho-Ser18) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Myosin regulatory light chain 2 (Phospho-Ser18) Antibody: A synthesized peptide derived from human Myosin regulatory light chain 2 (Phospho-Ser18)
Modifications Phospho-specific

MYL12B rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MYL12B

Rabbit Polyclonal Anti-MYL12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE

Rabbit Polyclonal Anti-MYL12B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL12B

MYL12B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL12B

MYL12B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MYL12B

MYL12B Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human MYL12B (NP_291024.1).
Modifications Unmodified