Products

Jump to Filters
View as table Download
PDE2A Rabbit Polyclonal Antibody
TA341106

USD 425.00

5 Days

Rabbit Polyclonal Anti-PDE2A Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen Pde2 / PDE2A antibody was raised against synthetic 17 amino acid peptide from N-terminus of human PDE2A. Percent identity with other species by BLAST analysis: Human, Gorilla, Marmoset, Dog, Panda, Horse (100%); Gibbon, Monkey, Mouse, Rat, Bovine, Elephant, Rabbit (94%); Pig (88%).
PDE2A Rabbit Polyclonal Antibody
TA342145

USD 375.00

5 Days

Rabbit polyclonal Anti-Pde2a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pde2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG