Rabbit Polyclonal Anti-PPM1M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1M antibody: synthetic peptide directed towards the middle region of human PPM1M. Synthetic peptide located within the following region: VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY |
Rabbit Polyclonal Anti-PPM1M Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1M antibody: synthetic peptide directed towards the middle region of human PPM1M. Synthetic peptide located within the following region: RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL |
PPM1M rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PPM1M |
PPM1M Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 213-459 of human PPM1M (NP_653242.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
