Products

View as table Download

Rabbit Polyclonal Anti-SEMA6D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D. Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY

Rabbit Polyclonal Anti-SEMA6D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D. Synthetic peptide located within the following region: KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN

Rabbit Polyclonal Anti-SEMA6D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6D

SEMA6D rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6D