Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-TAF4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF4 Antibody: A synthesized peptide derived from human TAF4 |
Products
View as table Download
Rabbit polyclonal anti-TAF4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF4. |
Rabbit Polyclonal Anti-TAF4 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL |
TAF4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAF4 |
Active filters
Target Symbol
- TAF4
Clonalities
- Polyclonal