Rabbit polyclonal anti-AASS antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human AASS. |
Rabbit polyclonal anti-AASS antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human AASS. |
Rabbit Polyclonal Anti-AASS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AASS antibody is: synthetic peptide directed towards the C-terminal region of Human AASS. Synthetic peptide located within the following region: HHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTP |