Products

View as table Download

Rabbit Polyclonal ACTL6B Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTL6B antibody: human ACTL6B (actin-like 6B), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein.

Rabbit Polyclonal Anti-ACTL6B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTL6B antibody: synthetic peptide directed towards the middle region of human ACTL6B. Synthetic peptide located within the following region: GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Goat Polyclonal Antibody against ACTL6A / ACTL6B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence YEEGGKQCVERKCP, from the C Terminus of the protein sequence according to NP_057272, NP_004292.